PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009782602.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 675aa    MW: 75070.4 Da    PI: 5.89
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009782602.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.39.7e-1302936591373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cAea+ s++ + +++l+arl elasp+g+p+ Rl+ayfteALa r+ar ++++++++pp++ + +  +++ +al+l+++vsPi+kf h
  XP_009782602.1 293 LISLLVSCAEAIGSRNVTGVNQLIARLGELASPRGSPICRLTAYFTEALALRVARIWPHIFHIIPPRDLD-RLDDDSSTALRLLNQVSPIPKFIH 386
                     5799****************************************************************98.5678888999************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +t N+ +l+a+eg++rvHiiDfdi+qGlQWp+L+q+LasRp++p ++RiTg+g+    sk+ l etg+rLa+fAe+l++ fef++ v++rled++
  XP_009782602.1 387 FTSNEILLRAFEGKDRVHIIDFDIKQGLQWPSLFQSLASRPNPPTHVRITGIGE----SKQDLVETGDRLAEFAEALNLAFEFHP-VVDRLEDVR 476
                     ******************************************************....9**************************.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     l++L+vk+gE++aVn++lq+hrll +s       +++L l++s++P+++ ++eqea+hn++s+ +r++++l+yy+a+fds+  +lp++s  rik+
  XP_009782602.1 477 LWMLHVKEGESVAVNCALQMHRLLYDSSGGIL--RDFLGLIRSTNPTIILMAEQEAEHNEPSLEARLVNSLRYYAAVFDSIGFSLPPDSPSRIKI 569
                     ***********************966655444..79*********************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve...eesgslvlgWkdrpLvsvSaW 373
                     E+  ++r+i+n++aceg++r+erhe ++kWr+ +e+ GF+   ++e++  q ++ll++++ + +rv    +++++l+l W d+pL +vSaW
  XP_009782602.1 570 EEL-FARDIRNIIACEGRDRTERHECFGKWRKLMEQGGFRCTGITERELLQSQMLLKMYSCEDFRVIkqgNDDAALTLSWLDQPLCTVSAW 659
                     *98.********************************************************88899984445589999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.74267637IPR005202Transcription factor GRAS
PfamPF035143.4E-127293659IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MLAGCSSTLL SPRHRLRSEA SAQFQACNFP SMSTQRLDLP CSFARKDNPR SQSIRPVGSL  60
SVDKPIETKN GSCSLKQNIR LPPSPTTAQT SSYVEGRRES KDEFWEKGRS LKRYADQGCF  120
DDDNCMSRGA KRKKGNRKSV DCSEEVEGYG LSLGQLGGGN FWLQSGYNVS RSVQAAAPFS  180
FSCSGEEESV CYVPSEVISP PPPLSNNPWI DSVVTEITNF GDKNVSTSQD PAKEASVSSA  240
SLDSHGLVLR LNENPEEHEL GNGSRAPNPN DRSEVVAAHN EHNNHREDDA AELISLLVSC  300
AEAIGSRNVT GVNQLIARLG ELASPRGSPI CRLTAYFTEA LALRVARIWP HIFHIIPPRD  360
LDRLDDDSST ALRLLNQVSP IPKFIHFTSN EILLRAFEGK DRVHIIDFDI KQGLQWPSLF  420
QSLASRPNPP THVRITGIGE SKQDLVETGD RLAEFAEALN LAFEFHPVVD RLEDVRLWML  480
HVKEGESVAV NCALQMHRLL YDSSGGILRD FLGLIRSTNP TIILMAEQEA EHNEPSLEAR  540
LVNSLRYYAA VFDSIGFSLP PDSPSRIKIE ELFARDIRNI IACEGRDRTE RHECFGKWRK  600
LMEQGGFRCT GITERELLQS QMLLKMYSCE DFRVIKQGND DAALTLSWLD QPLCTVSAWS  660
PLDAAGSSSS YYQRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-522906591374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092790.0AP009279.1 Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0197J17, complete sequence.
GenBankAP0102630.0AP010263.1 Solanum lycopersicum DNA, chromosome 8, clone: C08SLm0019C20, complete sequence.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009782602.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLM0ZTN80.0M0ZTN8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000078790.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55682434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein